PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03321.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 521aa    MW: 57205 Da    PI: 7.5698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03321.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-183683148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed++l d+v+++G g+W+++ r  g++R++k+c++rw ++l
  mrna03321.1-v1.0-hybrid 36 KGPWTATEDQILMDYVRKHGEGNWNSVQRNSGLNRCGKSCRLRWANHL 83
                             79******************************************9986 PP

2Myb_DNA-binding51.91.7e-1689132146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T+eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
  mrna03321.1-v1.0-hybrid  89 KGAFTPEEERLILELHAKYGNK-WARMASQLP-GRTDNEIKNYWNT 132
                              799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1473183IPR017930Myb domain
SuperFamilySSF466891.08E-3133130IPR009057Homeodomain-like
SMARTSM007178.5E-153585IPR001005SANT/Myb domain
PfamPF002496.0E-163683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-243790IPR009057Homeodomain-like
CDDcd001674.18E-113883No hitNo description
PROSITE profilePS5129426.45784138IPR017930Myb domain
SMARTSM007172.3E-1788136IPR001005SANT/Myb domain
PfamPF002491.0E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2691137IPR009057Homeodomain-like
CDDcd001677.25E-1391132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MAHNGDGING GDAVLSSEGR SSETSGGMEG NNGLKKGPWT ATEDQILMDY VRKHGEGNWN  60
SVQRNSGLNR CGKSCRLRWA NHLRPNLKKG AFTPEEERLI LELHAKYGNK WARMASQLPG  120
RTDNEIKNYW NTRVKRRQRQ GLPLYPHDIK QSQQQSHSQS QPTSLTVPTS TGLPPTGQNY  180
SFQFQSSSSS NAHQLPPIGP SHHPHHSTAS SPKSAINHYL PVFDHSTDPS FTFNRPTPIL  240
GAPLRYKRYR NSHGISPPVS PTPQRSNSIL RTSSMPDISY NQHFAPGNMS MPDMASFQFQ  300
PPRNFSGSLP PLPRSTSSQF DFGDSTRPLY SVKSSELPSS QVSQTQSPCD QLTNDNKLHV  360
AAAANGTHCS NVLEELLQEA EALASVATPR NSKASIGLLG SFEDKHGLDG YGRWLQAAGS  420
TNNSVSDMKQ IQDHHDQMNY SLPEDLSKLF RFIPSTEPVS DWYSTDSGEL SNGGQSSGVT  480
EASFEFDMQQ NMASLFPSIV ASSADHDRGP NNWDNLPGMC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31341375107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295832.10.0PREDICTED: uncharacterized protein LOC101303499 isoform X2
TrEMBLM5X4J11e-129M5X4J1_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-70myb domain protein 101